Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
twitter

Escherichia coli K-12 substr. MG1655 Polypeptide: protein used in recombination and DNA repair



Gene: recN Accession Numbers: EG10831 (EcoCyc), b2616, ECK2612

Synonyms: radB

Regulation Summary Diagram: ?

Summary:
RecN is required for repair of double strand breaks in the chromosome when these breaks occur at two or more locations, but not when there is a single break in the chromosome. DksA works with RecN in this capacity. A recN dksA double mutant becomes filamentous and is unable to divide after induction of double-strand breaks [Meddows05].

recN mutations result in increased sensitivity to Mitomycin C and ionizing radiation correlated with reduced UV inducible repair of double strand breaks in DNA [Picksley84]. Multiple copies of recN increased resistance of recN mutants to ionizing radiation and decreased survival of wild-type cells [Picksley85]. uvrABC mutants require RecN for repair of 8-methoxypsoralen crosslinks, but only under conditions in which recombination between homologous regions of DNA can occur [Cupido85]. recN, required for recBC-independent recombination, was shown to be a SOS response protein [Finch85]. recN mutants have constitutively active SOS functions [Dunman00]. A recN mutant is approximately 90% deficient in its ability to repair X-ray induced double-strand breaks [Sargentini86]. RecN is involved in postreplication repair of daughter strand gaps [Wang88]. RecN is important for bleomycin lesion repair [Kosa04]. RecN has been implicated in the protection of DNA that is afforded by the clinical radioprotector amifostine [Almeida10].

Locations: cytosol

Map Position: [2,749,817 -> 2,751,478] (59.27 centisomes)
Length: 1662 bp / 553 aa

Molecular Weight of Polypeptide: 61.396 kD (from nucleotide sequence), 62 kD (experimental) [Picksley85 ]

Unification Links: ASAP:ABE-0008611 , CGSC:10872 , DIP:DIP-10655N , EchoBASE:EB0824 , EcoGene:EG10831 , EcoliWiki:b2616 , Mint:MINT-1269449 , ModBase:P05824 , OU-Microarray:b2616 , PortEco:recN , PR:PRO_000023704 , Protein Model Portal:P05824 , RefSeq:YP_026172 , RegulonDB:EG10831 , SMR:P05824 , String:511145.b2616 , UniProt:P05824

Relationship Links: InterPro:IN-FAMILY:IPR003395 , InterPro:IN-FAMILY:IPR004604 , InterPro:IN-FAMILY:IPR027417 , Panther:IN-FAMILY:PTHR11059 , Pfam:IN-FAMILY:PF02463

In Paralogous Gene Group: 586 (2 members)

Genetic Regulation Schematic: ?

GO Terms:

Biological Process: GO:0000724 - double-strand break repair via homologous recombination Inferred from experiment [Cupido85]
GO:0006302 - double-strand break repair Inferred from experiment [Picksley84, Meddows05]
GO:0006974 - cellular response to DNA damage stimulus Inferred from experiment Inferred by computational analysis [UniProtGOA11, Khil02]
GO:0009432 - SOS response Inferred from experiment [Finch85]
GO:0006281 - DNA repair Inferred by computational analysis [UniProtGOA11, GOA01]
GO:0006310 - DNA recombination Inferred by computational analysis [GOA01]
Molecular Function: GO:0005515 - protein binding Inferred from experiment [Rajagopala14, Butland05]
GO:0000166 - nucleotide binding Inferred by computational analysis [UniProtGOA11]
GO:0003677 - DNA binding Inferred by curator
GO:0005524 - ATP binding Inferred by computational analysis [UniProtGOA11, GOA01]
Cellular Component: GO:0005737 - cytoplasm Inferred by computational analysis [UniProtGOA11a, UniProtGOA11]
GO:0005829 - cytosol Inferred by computational analysis [DiazMejia09]

MultiFun Terms: cell processes SOS response
information transfer DNA related DNA recombination
information transfer DNA related DNA repair

Essentiality data for recN knockouts: ?

Growth Medium Growth? T (°C) O2 pH Osm/L Growth Observations
LB enriched Yes 37 Aerobic 6.95   Yes [Gerdes03, Comment 1]
LB Lennox Yes 37 Aerobic 7   Yes [Baba06, Comment 2]
M9 medium with 1% glycerol Yes 37 Aerobic 7.2 0.35 Yes [Joyce06, Comment 3]
MOPS medium with 0.4% glucose Yes 37 Aerobic 7.2 0.22 Yes [Baba06, Comment 2]

Sequence Features

Feature Class Location Citations Comment
Nucleotide-Phosphate-Binding-Region 29 -> 36
[UniProt10]
UniProt: ATP; Non-Experimental Qualifier: potential;
Sequence-Conflict 59 -> 60
[Rostas87, UniProt10a]
Alternate sequence: AA → C; UniProt: (in Ref. 1; CAA68435);
Sequence-Conflict 76
[Rostas87, UniProt10a]
Alternate sequence: A → R; UniProt: (in Ref. 1; CAA68435);
Sequence-Conflict 535 -> 553
[Rostas87, UniProt10a]
Alternate sequence: GGSEVTRNTLANAKELLAA → VAVKSHVIHWRMRKNCLQRKLFSCFTVRVNSKTP; UniProt: (in Ref. 1; CAA68435);


Gene Local Context (not to scale): ?

Transcription Unit:

Notes:

History:
10/20/97 Gene b2616 from Blattner lab Genbank (v. M52) entry merged into EcoCyc gene EG10831.


References

Almeida10: Almeida E, Fuentes JL, Cuetara E, Prieto E, Llagostera M (2010). "Amifostine protection against induced DNA damage in gamma-irradiated Escherichia coli cells depend on recN DNA repair gene product activity." Environ Toxicol 25(2);130-6. PMID: 19399845

Baba06: Baba T, Ara T, Hasegawa M, Takai Y, Okumura Y, Baba M, Datsenko KA, Tomita M, Wanner BL, Mori H (2006). "Construction of Escherichia coli K-12 in-frame, single-gene knockout mutants: the Keio collection." Mol Syst Biol 2;2006.0008. PMID: 16738554

Butland05: Butland G, Peregrin-Alvarez JM, Li J, Yang W, Yang X, Canadien V, Starostine A, Richards D, Beattie B, Krogan N, Davey M, Parkinson J, Greenblatt J, Emili A (2005). "Interaction network containing conserved and essential protein complexes in Escherichia coli." Nature 433(7025);531-7. PMID: 15690043

Cupido85: Cupido M, Bridges BA (1985). "Uvr-independent repair of 8-methoxypsoralen crosslinks in Escherichia coli: evidence for a recombinational process." Mutat Res 146(2);135-41. PMID: 2993876

DiazMejia09: Diaz-Mejia JJ, Babu M, Emili A (2009). "Computational and experimental approaches to chart the Escherichia coli cell-envelope-associated proteome and interactome." FEMS Microbiol Rev 33(1);66-97. PMID: 19054114

Dunman00: Dunman PM, Ren L, Rahman MS, Palejwala VA, Murphy HS, Volkert MR, Humayun MZ (2000). "Escherichia coli cells defective for the recN gene display constitutive elevation of mutagenesis at 3,N(4)-ethenocytosine via an SOS-induced mechanism." Mol Microbiol 37(3);680-6. PMID: 10931361

Finch85: Finch PW, Chambers P, Emmerson PT (1985). "Identification of the Escherichia coli recN gene product as a major SOS protein." J Bacteriol 164(2);653-8. PMID: 2997124

Gerdes03: Gerdes SY, Scholle MD, Campbell JW, Balazsi G, Ravasz E, Daugherty MD, Somera AL, Kyrpides NC, Anderson I, Gelfand MS, Bhattacharya A, Kapatral V, D'Souza M, Baev MV, Grechkin Y, Mseeh F, Fonstein MY, Overbeek R, Barabasi AL, Oltvai ZN, Osterman AL (2003). "Experimental determination and system level analysis of essential genes in Escherichia coli MG1655." J Bacteriol 185(19);5673-84. PMID: 13129938

GOA01: GOA, DDB, FB, MGI, ZFIN (2001). "Gene Ontology annotation through association of InterPro records with GO terms."

Joyce06: Joyce AR, Reed JL, White A, Edwards R, Osterman A, Baba T, Mori H, Lesely SA, Palsson BO, Agarwalla S (2006). "Experimental and computational assessment of conditionally essential genes in Escherichia coli." J Bacteriol 188(23);8259-71. PMID: 17012394

Khil02: Khil PP, Camerini-Otero RD (2002). "Over 1000 genes are involved in the DNA damage response of Escherichia coli." Mol Microbiol 44(1);89-105. PMID: 11967071

Kosa04: Kosa JL, Zdraveski ZZ, Currier S, Marinus MG, Essigmann JM (2004). "RecN and RecG are required for Escherichia coli survival of Bleomycin-induced damage." Mutat Res 554(1-2);149-57. PMID: 15450413

Meddows05: Meddows TR, Savory AP, Grove JI, Moore T, Lloyd RG (2005). "RecN protein and transcription factor DksA combine to promote faithful recombinational repair of DNA double-strand breaks." Mol Microbiol 57(1);97-110. PMID: 15948952

Picksley84: Picksley SM, Attfield PV, Lloyd RG (1984). "Repair of DNA double-strand breaks in Escherichia coli K12 requires a functional recN product." Mol Gen Genet 195(1-2);267-74. PMID: 6092851

Picksley85: Picksley SM, Morton SJ, Lloyd RG (1985). "The recN locus of Escherichia coli K12: molecular analysis and identification of the gene product." Mol Gen Genet 201(2);301-7. PMID: 3003532

Rajagopala14: Rajagopala SV, Sikorski P, Kumar A, Mosca R, Vlasblom J, Arnold R, Franca-Koh J, Pakala SB, Phanse S, Ceol A, Hauser R, Siszler G, Wuchty S, Emili A, Babu M, Aloy P, Pieper R, Uetz P (2014). "The binary protein-protein interaction landscape of Escherichia coli." Nat Biotechnol 32(3);285-90. PMID: 24561554

Rostas87: Rostas K, Morton SJ, Picksley SM, Lloyd RG (1987). "Nucleotide sequence and LexA regulation of the Escherichia coli recN gene." Nucleic Acids Res 15(13);5041-9. PMID: 3037486

Sargentini86: Sargentini NJ, Smith KC (1986). "Quantitation of the involvement of the recA, recB, recC, recF, recJ, recN, lexA, radA, radB, uvrD, and umuC genes in the repair of X-ray-induced DNA double-strand breaks in Escherichia coli." Radiat Res 107(1);58-72. PMID: 3526390

UniProt10: UniProt Consortium (2010). "UniProt version 2010-07 released on 2010-06-15 00:00:00." Database.

UniProt10a: UniProt Consortium (2010). "UniProt version 2010-11 released on 2010-11-02 00:00:00." Database.

UniProtGOA11: UniProt-GOA (2011). "Gene Ontology annotation based on manual assignment of UniProtKB keywords in UniProtKB/Swiss-Prot entries."

UniProtGOA11a: UniProt-GOA (2011). "Gene Ontology annotation based on the manual assignment of UniProtKB Subcellular Location terms in UniProtKB/Swiss-Prot entries."

Wang88: Wang TC, Smith KC (1988). "Different effects of recJ and recN mutations on the postreplication repair of UV-damaged DNA in Escherichia coli K-12." J Bacteriol 170(6);2555-9. PMID: 3286613


Report Errors or Provide Feedback
Please cite the following article in publications resulting from the use of EcoCyc: Nucleic Acids Research 41:D605-12 2013
Page generated by SRI International Pathway Tools version 18.5 on Tue Nov 25, 2014, BIOCYC13A.