Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
twitter

Escherichia coli K-12 substr. MG1655 Polypeptide: predicted ferritin-like protein



Gene: ftnB Accession Numbers: G7033 (EcoCyc), b1902, ECK1900

Synonyms: yecI

Regulation Summary Diagram: ?

Summary:
No information about this protein was found by a literature search conducted on September 5, 2006.

Locations: cytosol

Map Position: [1,984,949 -> 1,985,452] (42.78 centisomes)
Length: 504 bp / 167 aa

Molecular Weight of Polypeptide: 18.894 kD (from nucleotide sequence)

Unification Links: ASAP:ABE-0006333 , EchoBASE:EB2967 , EcoGene:EG13175 , EcoliWiki:b1902 , ModBase:P0A9A2 , OU-Microarray:b1902 , PortEco:ftnB , PR:PRO_000022713 , Pride:P0A9A2 , Protein Model Portal:P0A9A2 , RefSeq:NP_416415 , RegulonDB:G7033 , SMR:P0A9A2 , String:511145.b1902 , UniProt:P0A9A2

Relationship Links: InterPro:IN-FAMILY:IPR001519 , InterPro:IN-FAMILY:IPR008331 , InterPro:IN-FAMILY:IPR009040 , InterPro:IN-FAMILY:IPR009078 , InterPro:IN-FAMILY:IPR012347 , Panther:IN-FAMILY:PTHR11431 , Pfam:IN-FAMILY:PF00210 , Prosite:IN-FAMILY:PS50905

In Paralogous Gene Group: 359 (2 members)

Genetic Regulation Schematic: ?

GO Terms:

Biological Process: GO:0006879 - cellular iron ion homeostasis Inferred by computational analysis [GOA01a]
Molecular Function: GO:0008199 - ferric iron binding Inferred by computational analysis [GOA01a]
Cellular Component: GO:0005829 - cytosol Inferred from experiment Inferred by computational analysis [DiazMejia09, Zhang07]
GO:0005737 - cytoplasm Inferred by computational analysis [UniProtGOA11, UniProtGOA11a]

MultiFun Terms: cell processes adaptations Fe aquisition

Essentiality data for ftnB knockouts: ?

Growth Medium Growth? T (°C) O2 pH Osm/L Growth Observations
LB enriched Yes 37 Aerobic 6.95   Yes [Gerdes03, Comment 1]
LB Lennox Yes 37 Aerobic 7   Yes [Baba06, Comment 2]
M9 medium with 1% glycerol Yes 37 Aerobic 7.2 0.35 Yes [Joyce06, Comment 3]
MOPS medium with 0.4% glucose Yes 37 Aerobic 7.2 0.22 Yes [Baba06, Comment 2]

Credits:
Last-Curated ? 05-Sep-2006 by Keseler I , SRI International


Sequence Features

Feature Class Location Citations Comment
Conserved-Region 1 -> 145
[UniProt09]
UniProt: Ferritin-like diiron;
Sequence-Conflict 117
[Robison95, UniProt10]
Alternate sequence: V → A; UniProt: (in Ref. 1; AAA81671);
Sequence-Conflict 128
[Robison95, UniProt10]
Alternate sequence: Q → E; UniProt: (in Ref. 1; AAA81671);
Sequence-Conflict 133 -> 167
[Robison95, UniProt10]
Alternate sequence: LLQTILDEVRSAKLAGMCPVQTDQHVLNVVSHQLH → VAANHS; UniProt: (in Ref. 1; AAA81671);


Gene Local Context (not to scale): ?

Transcription Units:

Notes:

History:
Markus Krummenacker on Tue Oct 14, 1997:
Gene object created from Blattner lab Genbank (v. M52) entry.


References

Baba06: Baba T, Ara T, Hasegawa M, Takai Y, Okumura Y, Baba M, Datsenko KA, Tomita M, Wanner BL, Mori H (2006). "Construction of Escherichia coli K-12 in-frame, single-gene knockout mutants: the Keio collection." Mol Syst Biol 2;2006.0008. PMID: 16738554

DiazMejia09: Diaz-Mejia JJ, Babu M, Emili A (2009). "Computational and experimental approaches to chart the Escherichia coli cell-envelope-associated proteome and interactome." FEMS Microbiol Rev 33(1);66-97. PMID: 19054114

Gerdes03: Gerdes SY, Scholle MD, Campbell JW, Balazsi G, Ravasz E, Daugherty MD, Somera AL, Kyrpides NC, Anderson I, Gelfand MS, Bhattacharya A, Kapatral V, D'Souza M, Baev MV, Grechkin Y, Mseeh F, Fonstein MY, Overbeek R, Barabasi AL, Oltvai ZN, Osterman AL (2003). "Experimental determination and system level analysis of essential genes in Escherichia coli MG1655." J Bacteriol 185(19);5673-84. PMID: 13129938

GOA01a: GOA, DDB, FB, MGI, ZFIN (2001). "Gene Ontology annotation through association of InterPro records with GO terms."

Joyce06: Joyce AR, Reed JL, White A, Edwards R, Osterman A, Baba T, Mori H, Lesely SA, Palsson BO, Agarwalla S (2006). "Experimental and computational assessment of conditionally essential genes in Escherichia coli." J Bacteriol 188(23);8259-71. PMID: 17012394

Robison95: Robison K., Estep P., O'Keeffe T., Church G.M. (1995). Data submission to EMBL/GenBank/DDBJ databases on 1995-10.

UniProt09: UniProt Consortium (2009). "UniProt version 15.8 released on 2009-10-01 00:00:00." Database.

UniProt10: UniProt Consortium (2010). "UniProt version 2010-11 released on 2010-11-02 00:00:00." Database.

UniProtGOA11: UniProt-GOA (2011). "Gene Ontology annotation based on the manual assignment of UniProtKB Subcellular Location terms in UniProtKB/Swiss-Prot entries."

UniProtGOA11a: UniProt-GOA (2011). "Gene Ontology annotation based on manual assignment of UniProtKB keywords in UniProtKB/Swiss-Prot entries."

Zhang07: Zhang N, Chen R, Young N, Wishart D, Winter P, Weiner JH, Li L (2007). "Comparison of SDS- and methanol-assisted protein solubilization and digestion methods for Escherichia coli membrane proteome analysis by 2-D LC-MS/MS." Proteomics 7(4);484-93. PMID: 17309111

Other References Related to Gene Regulation

Rhodius05: Rhodius VA, Suh WC, Nonaka G, West J, Gross CA (2005). "Conserved and variable functions of the sigmaE stress response in related genomes." PLoS Biol 4(1);e2. PMID: 16336047

Yamamoto06: Yamamoto K, Ishihama A (2006). "Characterization of copper-inducible promoters regulated by CpxA/CpxR in Escherichia coli." Biosci Biotechnol Biochem 70(7);1688-95. PMID: 16861804


Report Errors or Provide Feedback
Please cite the following article in publications resulting from the use of EcoCyc: Nucleic Acids Research 41:D605-12 2013
Page generated by SRI International Pathway Tools version 18.5 on Fri Nov 28, 2014, biocyc12.