Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
twitter

Escherichia coli K-12 substr. MG1655 Polypeptide: trehalose PTS permease - TreB subunit



Gene: treB Accession Numbers: EG12127 (EcoCyc), b4240, ECK4235

Synonyms: Enzyme IIBCtre, enzyme IIBC component of trehalose PTS

Regulation Summary Diagram: ?

Component of: trehalose PTS permease (extended summary available)

Summary:
TreB contains PTS Enzyme IIB and IIC domains [Klein95]

Gene Citations: [Horlacher97]

Locations: inner membrane

Map Position: [4,462,782 <- 4,464,203] (96.19 centisomes)
Length: 1422 bp / 473 aa

Molecular Weight of Polypeptide: 51.081 kD (from nucleotide sequence)

Unification Links: ASAP:ABE-0013872 , CGSC:34601 , EchoBASE:EB2048 , EcoGene:EG12127 , EcoliWiki:b4240 , Mint:MINT-6478335 , ModBase:P36672 , OU-Microarray:b4240 , PortEco:treB , PR:PRO_000024107 , Pride:P36672 , Protein Model Portal:P36672 , RefSeq:NP_418661 , RegulonDB:EG12127 , SMR:P36672 , String:511145.b4240 , UniProt:P36672

Relationship Links: InterPro:IN-FAMILY:IPR001996 , InterPro:IN-FAMILY:IPR003352 , InterPro:IN-FAMILY:IPR004719 , InterPro:IN-FAMILY:IPR011296 , InterPro:IN-FAMILY:IPR011535 , InterPro:IN-FAMILY:IPR013013 , InterPro:IN-FAMILY:IPR018113 , Pfam:IN-FAMILY:PF00367 , Pfam:IN-FAMILY:PF02378 , Prosite:IN-FAMILY:PS01035 , Prosite:IN-FAMILY:PS51098 , Prosite:IN-FAMILY:PS51103

Gene-Reaction Schematic: ?

Genetic Regulation Schematic: ?

GO Terms:

Biological Process: GO:0009401 - phosphoenolpyruvate-dependent sugar phosphotransferase system Inferred from experiment Inferred by computational analysis [UniProtGOA11a, GOA01a, Boos87, Marechal84]
GO:0015771 - trehalose transport Inferred from experiment Inferred by computational analysis [GOA01a, Marechal84, Boos90, Klein95]
GO:0006810 - transport Inferred by computational analysis [UniProtGOA11a]
GO:0008643 - carbohydrate transport Inferred by computational analysis [UniProtGOA11a]
GO:0016310 - phosphorylation Inferred by computational analysis [UniProtGOA11a]
GO:0034219 - carbohydrate transmembrane transport Inferred by computational analysis [GOA01, GOA01a]
Molecular Function: GO:0090589 - protein-phosphocysteine-trehalose phosphotransferase system transporter activity Inferred by computational analysis Inferred from experiment [Marechal84, Boos90, Klein95]
GO:0008982 - protein-N(PI)-phosphohistidine-sugar phosphotransferase activity Inferred by computational analysis [GOA01, GOA01a]
GO:0015574 - trehalose transmembrane transporter activity Inferred by computational analysis [GOA01a]
GO:0016301 - kinase activity Inferred by computational analysis [UniProtGOA11a]
GO:0016740 - transferase activity Inferred by computational analysis [UniProtGOA11a]
Cellular Component: GO:0005886 - plasma membrane Inferred from experiment Inferred by computational analysis [UniProtGOA11, UniProtGOA11a, DiazMejia09, Daley05, Boos90]
GO:0005887 - integral component of plasma membrane Inferred by computational analysis [Klein95]
GO:0016020 - membrane Inferred by computational analysis [UniProtGOA11a, GOA01a]
GO:0016021 - integral component of membrane Inferred by computational analysis [UniProtGOA11a, GOA01a]

MultiFun Terms: cell structure membrane
metabolism central intermediary metabolism misc. glucose metabolism
transport Group Translocators Phosphotransferase Systems (PEP-dependent PTS)

Essentiality data for treB knockouts: ?

Growth Medium Growth? T (°C) O2 pH Osm/L Growth Observations
LB enriched Yes 37 Aerobic 6.95   Yes [Gerdes et al., 2003, Comment 1]
LB Lennox Yes 37 Aerobic 7   Yes [Baba et al., 2006, Comment 2]
M9 medium with 1% glycerol Yes 37 Aerobic 7.2 0.35 Yes [Joyce06, Comment 3]
MOPS medium with 0.4% glucose Yes 37 Aerobic 7.2 0.22 Yes [Baba et al., 2006, Comment 2]
Yes [Feist07, Comment 4]

Subunit of: trehalose PTS permease

Synonyms: EIITre, Enzyme II Tre

Subunit composition of trehalose PTS permease = [TreB]2[Crr]
         trehalose PTS permease - TreB subunit = TreB (summary available)
         Enzyme IIAGlc; Crr = Crr (extended summary available)

Summary:
TreB, the trehalose PTS permease, belongs to the functional superfamily of the phosphoenolpyruvate (PEP)-dependent, sugar transporting phosphotransferase system (PTSsugar). The PTSsugar transports and simultaneously phosphorylates its sugar substrates in a process called group translocation (reviewed in [Postma93]). TreB together with Crr (Enzyme IIAGlc or Enzyme IIACrr) takes up exogenous trehalose, releasing the phosphate ester into the cell cytoplasm for hydrolysis by catabolic trehalose-6-phosphate hydrolase and subsequent metabolism via glycolysis (see trehalose degradation I (low osmolarity).

TreB, the Enzyme IITre complex, possesses two domains in a single polypeptide chain with the domain order IIB-IIC [Klein95]. The IIC domain is predicted to contain 8 membrane spanning regions and to function as the permease proper. The IIB domain is localized to the cytoplasmic side of the membrane and contains characteristic amino acid sequence motifs that are believed to be involved in phosphoryl transfer [Klein95]. TreB does not contain an Enzyme IIA domain but relies on the soluble protein Enzyme IIACrr for this function. TreB/Crr is a member of the PTS Glucose-Glucoside family of transporters [Saier14].

The overall PTS-mediated phosphoryl transfer reaction, requiring the two general energy coupling proteins of the PTS, Enzyme I (PtsI) and HPr (PtsH), as well as the soluble Enzyme IIACrr protein and the two domains of the Enzyme IItre complex can be represented as:

PEP --> Enzyme I-Phis189 --> HPr-Phis15 --> Enzyme IIAGlc-Phis91 --> Enzyme IIB-Pcys29-(Enzyme IIC) -> trehalose-6-P

TreB transports trehalose with micromolar affinity [Boos90].

The tre operon is inducible in wild type E. coli K-12 by external trehelose and repressed at high osmolarity (250mM NaCl) [Boos90]. The treBC operon contains the treB gene encoding the Enzyme IITre and the treC gene encoding trehelose-6-phosphate hydrolase that hydrolyzes the α,α-glycosidic bond in trehalose-6-phosphate [Rimmele94]. The monocistronic treR operon, encoding the repressor of the treBC operon is upstream of the treBC operon and is transcribed in the same direction. tre operon expression is under the control of the cyclic AMP-cyclic AMP receptor protein (CRP) complex as well as that of TreR.

E. coli K-12 can also synthesize trehalose as an osmoprotectant (see trehalose biosynthesis I)

Review: [Strom93]

Citations: [Marechal84]

GO Terms:

Biological Process: GO:0015771 - trehalose transport Inferred from experiment [Klein95]
Molecular Function: GO:0090589 - protein-phosphocysteine-trehalose phosphotransferase system transporter activity Inferred by computational analysis Inferred from experiment [Marechal84, Klein95]


Enzymatic reaction of: trehalose PTS permease

Kinetic Parameters:

Substrate
Km (μM)
Citations
α,α-trehalose
16.0
[Boos90]

pH(opt): 6 [BRENDA14, Saier80], 6.5 [BRENDA14, Jacobson83], 7 [BRENDA14, Jacobson79], 7.5 [BRENDA14, Sutrina87], 8.5 [BRENDA14, Jacobson83], 9 [BRENDA14, Jacobson79], 9.5 [BRENDA14, Saier80]


Sequence Features

Feature Class Location Citations Comment
Conserved-Region 1 -> 89
[UniProt09]
UniProt: PTS EIIB type-1;
Active-Site 29
[UniProt, 2010]
UniProt: Phosphocysteine intermediate; for EIIB activity; Non-Experimental Qualifier: by similarity;
Conserved-Region 109 -> 473
[UniProt09]
UniProt: PTS EIIC type-1;
Transmembrane-Region 111 -> 131
[UniProt, 2010]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Sequence-Conflict 126 -> 127
[Klein95, UniProt10]
Alternate sequence: GL → PF; UniProt: (in Ref. 1; AAC43381);
Transmembrane-Region 159 -> 179
[UniProt, 2010]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Sequence-Conflict 184 -> 194
[Burland95, UniProt10]
Alternate sequence: GGTPILGIVLG → AQRRSLVSCLA; UniProt: (in Ref. 2; AAA97137);
Sequence-Conflict 187
[Klein95, UniProt10]
Alternate sequence: P → missing; UniProt: (in Ref. 1; AAC43381);
Transmembrane-Region 188 -> 208
[UniProt, 2010]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 226 -> 246
[UniProt, 2010]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 259 -> 279
[UniProt, 2010]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 301 -> 321
[UniProt, 2010]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Sequence-Conflict 307
[Klein95, UniProt10]
Alternate sequence: A → Q; UniProt: (in Ref. 1; AAC43381);
Transmembrane-Region 341 -> 361
[UniProt, 2010]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 371 -> 391
[UniProt, 2010]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 399 -> 419
[UniProt, 2010]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Sequence-Conflict 429 -> 473
[Klein95, UniProt10]
Alternate sequence: PGILSIQPSYWQVFALAMAIAIIIPIVLTSFIYQRKYRLGTLDIV → RNSLDSTELLAGVCAGNGYRHHHPDCTHLVYLSAEIPPGHAGHCLIFFGAQLRSHSQE; UniProt: (in Ref. 1; AAC43381);
Transmembrane-Region 441 -> 461
[UniProt, 2010]
UniProt: Helical;; Non-Experimental Qualifier: potential;


Gene Local Context (not to scale): ?

Transcription Unit:

Notes:

History:
10/20/97 Gene b4240 from Blattner lab Genbank (v. M52) entry merged into EcoCyc gene EG12127; confirmed by SwissProt match.


References

Baba et al., 2006: Baba T, Ara T, Hasegawa M, Takai Y, Okumura Y, Baba M, Datsenko KA, Tomita M, Wanner BL, Mori H (2006). "Construction of Escherichia coli K-12 in-frame, single-gene knockout mutants: the Keio collection." Mol Syst Biol 2;2006.0008. PMID: 16738554

Boos87: Boos W, Ehmann U, Bremer E, Middendorf A, Postma P (1987). "Trehalase of Escherichia coli. Mapping and cloning of its structural gene and identification of the enzyme as a periplasmic protein induced under high osmolarity growth conditions." J Biol Chem 1987;262(27);13212-8. PMID: 2820965

Boos90: Boos W, Ehmann U, Forkl H, Klein W, Rimmele M, Postma P (1990). "Trehalose transport and metabolism in Escherichia coli." J Bacteriol 172(6);3450-61. PMID: 2160944

BRENDA14: BRENDA team (2014). "Imported from BRENDA version existing on Aug 2014." http://www.brenda-enzymes.org.

Burland95: Burland V, Plunkett G, Sofia HJ, Daniels DL, Blattner FR (1995). "Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes." Nucleic Acids Res 23(12);2105-19. PMID: 7610040

Daley05: Daley DO, Rapp M, Granseth E, Melen K, Drew D, von Heijne G (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308(5726);1321-3. PMID: 15919996

DiazMejia09: Diaz-Mejia JJ, Babu M, Emili A (2009). "Computational and experimental approaches to chart the Escherichia coli cell-envelope-associated proteome and interactome." FEMS Microbiol Rev 33(1);66-97. PMID: 19054114

Feist07: Feist AM, Henry CS, Reed JL, Krummenacker M, Joyce AR, Karp PD, Broadbelt LJ, Hatzimanikatis V, Palsson BO (2007). "A genome-scale metabolic reconstruction for Escherichia coli K-12 MG1655 that accounts for 1260 ORFs and thermodynamic information." Mol Syst Biol 3;121. PMID: 17593909

Gerdes et al., 2003: Gerdes SY, Scholle MD, Campbell JW, Balazsi G, Ravasz E, Daugherty MD, Somera AL, Kyrpides NC, Anderson I, Gelfand MS, Bhattacharya A, Kapatral V, D'Souza M, Baev MV, Grechkin Y, Mseeh F, Fonstein MY, Overbeek R, Barabasi AL, Oltvai ZN, Osterman AL (2003). "Experimental determination and system level analysis of essential genes in Escherichia coli MG1655." J Bacteriol 185(19);5673-84. PMID: 13129938

GOA01: GOA, MGI (2001). "Gene Ontology annotation based on Enzyme Commission mapping." Genomics 74;121-128.

GOA01a: GOA, DDB, FB, MGI, ZFIN (2001). "Gene Ontology annotation through association of InterPro records with GO terms."

Horlacher97: Horlacher R, Boos W (1997). "Characterization of TreR, the major regulator of the Escherichia coli trehalose system." J Biol Chem 1997;272(20);13026-32. PMID: 9148912

Jacobson79: Jacobson GR, Lee CA, Saier MH (1979). "Purification of the mannitol-specific enzyme II of the Escherichia coli phosphoenolpyruvate:sugar phosphotransferase system." J Biol Chem 254(2);249-52. PMID: 368051

Jacobson83: Jacobson GR, Lee CA, Leonard JE, Saier MH (1983). "Mannitol-specific enzyme II of the bacterial phosphotransferase system. I. Properties of the purified permease." J Biol Chem 258(17);10748-56. PMID: 6350293

Joyce06: Joyce AR, Reed JL, White A, Edwards R, Osterman A, Baba T, Mori H, Lesely SA, Palsson BO, Agarwalla S (2006). "Experimental and computational assessment of conditionally essential genes in Escherichia coli." J Bacteriol 188(23);8259-71. PMID: 17012394

Klein95: Klein W, Horlacher R, Boos W (1995). "Molecular analysis of treB encoding the Escherichia coli enzyme II specific for trehalose." J Bacteriol 177(14);4043-52. PMID: 7608078

Marechal84: Marechal LR (1984). "Transport and metabolism of trehalose in Escherichia coli and Salmonella typhimurium." Arch Microbiol 137(1);70-3. PMID: 6370169

Postma93: Postma PW, Lengeler JW, Jacobson GR (1993). "Phosphoenolpyruvate:carbohydrate phosphotransferase systems of bacteria." Microbiol Rev 57(3);543-94. PMID: 8246840

Rimmele94: Rimmele M, Boos W (1994). "Trehalose-6-phosphate hydrolase of Escherichia coli." J Bacteriol 1994;176(18);5654-64. PMID: 8083158

Saier14: Saier MH, Reddy VS, Tamang DG, Vastermark A (2014). "The transporter classification database." Nucleic Acids Res 42(1);D251-8. PMID: 24225317

Saier80: Saier MH (1980). "Catalytic activities associated with the enzymes II of the bacterial phosphotransferase system." J Supramol Struct 14(3);281-94. PMID: 7012451

Strom93: Strom AR, Kaasen I (1993). "Trehalose metabolism in Escherichia coli: stress protection and stress regulation of gene expression." Mol Microbiol 1993;8(2);205-10. PMID: 8391102

Sutrina87: Sutrina SL, Waygood EB, Grenier FC, Saier MH (1987). "HPr/HPr-P phosphoryl exchange reaction catalyzed by the mannitol specific enzyme II of the bacterial phosphotransferase system." J Biol Chem 262(6);2636-41. PMID: 3102473

UniProt, 2010: UniProt Consortium (2010). "UniProt version 2010-07 released on 2010-06-15 00:00:00." Database.

UniProt09: UniProt Consortium (2009). "UniProt version 15.8 released on 2009-10-01 00:00:00." Database.

UniProt10: UniProt Consortium (2010). "UniProt version 2010-11 released on 2010-11-02 00:00:00." Database.

UniProtGOA11: UniProt-GOA (2011). "Gene Ontology annotation based on the manual assignment of UniProtKB Subcellular Location terms in UniProtKB/Swiss-Prot entries."

UniProtGOA11a: UniProt-GOA (2011). "Gene Ontology annotation based on manual assignment of UniProtKB keywords in UniProtKB/Swiss-Prot entries."

Other References Related to Gene Regulation

Liu04: Liu X, De Wulf P (2004). "Probing the ArcA-P modulon of Escherichia coli by whole genome transcriptional analysis and sequence recognition profiling." J Biol Chem 279(13);12588-97. PMID: 14711822

Zheng04: Zheng D, Constantinidou C, Hobman JL, Minchin SD (2004). "Identification of the CRP regulon using in vitro and in vivo transcriptional profiling." Nucleic Acids Res 32(19);5874-93. PMID: 15520470


Report Errors or Provide Feedback
Please cite the following article in publications resulting from the use of EcoCyc: Nucleic Acids Research 41:D605-12 2013
Page generated by SRI International Pathway Tools version 18.5 on Tue Nov 25, 2014, BIOCYC14B.