Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
BioCyc websites down
12/28 - 12/31
for maintenance.
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
BioCyc websites down
12/28 - 12/31
for maintenance.
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
BioCyc websites down
12/28 - 12/31
for maintenance.
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
BioCyc websites down
12/28 - 12/31
for maintenance.
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
BioCyc websites down
12/28 - 12/31
for maintenance.
twitter

Escherichia coli K-12 substr. MG1655 Polypeptide: fermentation/respiration switch protein



Gene: frsA Accession Numbers: EG11091 (EcoCyc), b0239, ECK0240

Synonyms: yafA

Regulation Summary Diagram: ?

Summary:
The FrsA protein was found to bind specifically to the unphosphorylated form of enzyme IIAGlc of the PEP-sugar phosphotransferase system and is suggested to aid IIAGlc in regulating the flux between respiration and fermentation pathways [Koo04]. Esterase activity of FrsA was discovered in a high-throughput screen of purified proteins [Kuznetsova05]. FrsA from Vibrio vulnificus is a pyruvate decarboxylase [Lee11].

Mutation of the frsA gene results in increased respiration on sugars including glucose. Overexpression of FrsA, on the other hand, results in increased fermentation of these sugars, leading to the accumulation of mixed-acid fermentation products [Koo04].

Orthologs of the frsA gene have so far only been found in facultative anaerobes belonging to the γ proteobacteria [Koo04].

FrsA: "fermentation/respiration switch protein" [Koo04]

Gene Citations: [Nuesch84]

Locations: cytosol

Map Position: [256,527 -> 257,771] (5.53 centisomes)
Length: 1245 bp / 414 aa

Molecular Weight of Polypeptide: 47.009 kD (from nucleotide sequence), 47 kD (experimental) [Koo04 ]

Unification Links: ASAP:ABE-0000817 , DIP:DIP-11208N , EchoBASE:EB1083 , EcoGene:EG11091 , EcoliWiki:b0239 , ModBase:P04335 , OU-Microarray:b0239 , PortEco:frsA , PR:PRO_000022698 , Pride:P04335 , Protein Model Portal:P04335 , RefSeq:NP_414774 , RegulonDB:EG11091 , SMR:P04335 , String:511145.b0239 , UniProt:P04335

Relationship Links: InterPro:IN-FAMILY:IPR010520 , Pfam:IN-FAMILY:PF06500

In Paralogous Gene Group: 255 (4 members)

GO Terms:

Biological Process: GO:0008152 - metabolic process Inferred by computational analysis Inferred from experiment [Kuznetsova05, UniProtGOA11a]
GO:0043470 - regulation of carbohydrate catabolic process Inferred from experiment [Koo04]
Molecular Function: GO:0005515 - protein binding Inferred from experiment [Koo04]
GO:0016787 - hydrolase activity Inferred from experiment Inferred by computational analysis [UniProtGOA11a, Kuznetsova05]
GO:0052689 - carboxylic ester hydrolase activity Inferred by computational analysis [UniProtGOA11a]
Cellular Component: GO:0005829 - cytosol Inferred by computational analysis [DiazMejia09]

MultiFun Terms: metabolism energy metabolism, carbon aerobic respiration
metabolism energy metabolism, carbon fermentation

Essentiality data for frsA knockouts: ?

Growth Medium Growth? T (°C) O2 pH Osm/L Growth Observations
LB enriched Yes 37 Aerobic 6.95   Yes [Gerdes03, Comment 1]
LB Lennox Yes 37 Aerobic 7   Yes [Baba06, Comment 2]
M9 medium with 1% glycerol Yes 37 Aerobic 7.2 0.35 Yes [Joyce06, Comment 3]
MOPS medium with 0.4% glucose Yes 37 Aerobic 7.2 0.22 Yes [Baba06, Comment 2]

Credits:
Last-Curated ? 30-Oct-2013 by Keseler I , SRI International


Sequence Features

Feature Class Location Citations Comment
Sequence-Conflict 242
[Takemoto96, Nuesch84, UniProt10a]
Alternate sequence: T → S; UniProt: (in Ref. 1 and 2);
Sequence-Conflict 277 -> 278
[Takemoto96, Nuesch84, UniProt10a]
Alternate sequence: NV → TL; UniProt: (in Ref. 1 and 2);
Sequence-Conflict 397 -> 414
[Takemoto96, Nuesch84, UniProt10a]
Alternate sequence: NFDKGLQEITDWIEKRLC → KILTKVFRKSPTGSKNACVKNLLNFANLVKQLHHNRR; UniProt: (in Ref. 1 and 2);


Gene Local Context (not to scale): ?

Transcription Unit:

Notes:

History:
Peter D. Karp on Thu Jan 16, 2003:
Predicted gene function revised as a result of E. coli genome reannotation by Serres et al. [Serres01 ].
10/20/97 Gene b0239 from Blattner lab Genbank (v. M52) entry merged into EcoCyc gene EG11091; confirmed by SwissProt match.


References

Baba06: Baba T, Ara T, Hasegawa M, Takai Y, Okumura Y, Baba M, Datsenko KA, Tomita M, Wanner BL, Mori H (2006). "Construction of Escherichia coli K-12 in-frame, single-gene knockout mutants: the Keio collection." Mol Syst Biol 2;2006.0008. PMID: 16738554

DiazMejia09: Diaz-Mejia JJ, Babu M, Emili A (2009). "Computational and experimental approaches to chart the Escherichia coli cell-envelope-associated proteome and interactome." FEMS Microbiol Rev 33(1);66-97. PMID: 19054114

Gerdes03: Gerdes SY, Scholle MD, Campbell JW, Balazsi G, Ravasz E, Daugherty MD, Somera AL, Kyrpides NC, Anderson I, Gelfand MS, Bhattacharya A, Kapatral V, D'Souza M, Baev MV, Grechkin Y, Mseeh F, Fonstein MY, Overbeek R, Barabasi AL, Oltvai ZN, Osterman AL (2003). "Experimental determination and system level analysis of essential genes in Escherichia coli MG1655." J Bacteriol 185(19);5673-84. PMID: 13129938

Joyce06: Joyce AR, Reed JL, White A, Edwards R, Osterman A, Baba T, Mori H, Lesely SA, Palsson BO, Agarwalla S (2006). "Experimental and computational assessment of conditionally essential genes in Escherichia coli." J Bacteriol 188(23);8259-71. PMID: 17012394

Koo04: Koo BM, Yoon MJ, Lee CR, Nam TW, Choe YJ, Jaffe H, Peterkofsky A, Seok YJ (2004). "A novel fermentation/respiration switch protein regulated by enzyme IIAGlc in Escherichia coli." J Biol Chem 279(30);31613-21. PMID: 15169777

Kuznetsova05: Kuznetsova E, Proudfoot M, Sanders SA, Reinking J, Savchenko A, Arrowsmith CH, Edwards AM, Yakunin AF (2005). "Enzyme genomics: Application of general enzymatic screens to discover new enzymes." FEMS Microbiol Rev 29(2);263-79. PMID: 15808744

Lee11: Lee KJ, Jeong CS, An YJ, Lee HJ, Park SJ, Seok YJ, Kim P, Lee JH, Lee KH, Cha SS (2011). "FrsA functions as a cofactor-independent decarboxylase to control metabolic flux." Nat Chem Biol 7(7);434-6. PMID: 21623357

Nuesch84: Nuesch J, Schumperli D (1984). "Structural and functional organization of the gpt gene region of Escherichia coli." Gene 32(1-2);243-9. PMID: 6397401

Serres01: Serres MH, Gopal S, Nahum LA, Liang P, Gaasterland T, Riley M (2001). "A functional update of the Escherichia coli K-12 genome." Genome Biol 2(9);RESEARCH0035. PMID: 11574054

Takemoto96: Takemoto K., Mori H., Murayama N., Kataoka K., Yano M., Itoh T., Yamamoto Y., Inokuchi H., Miki T., Hatada E., Fukuda R., Ichihara S., Mizuno T., Makino K., Nakata A., Yura T., Sampei G., Mizobuchi K. (1996). "Systematic sequencing of the Escherichia coli genome: analysis of the 4.0 - 6.0 min (189,987 - 281,416bp) region." Data submission to EMBL/GenBank/DDBJ databases on 1996-02.

UniProt10a: UniProt Consortium (2010). "UniProt version 2010-11 released on 2010-11-02 00:00:00." Database.

UniProtGOA11a: UniProt-GOA (2011). "Gene Ontology annotation based on manual assignment of UniProtKB keywords in UniProtKB/Swiss-Prot entries."

Other References Related to Gene Regulation

Harley87: Harley CB, Reynolds RP (1987). "Analysis of E. coli promoter sequences." Nucleic Acids Res 15(5);2343-61. PMID: 3550697


Report Errors or Provide Feedback
Please cite the following article in publications resulting from the use of EcoCyc: Nucleic Acids Research 41:D605-12 2013
Page generated by SRI International Pathway Tools version 18.5 on Sat Dec 20, 2014, BIOCYC13B.