Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
BioCyc websites down
12/28 - 12/31
for maintenance.
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
BioCyc websites down
12/28 - 12/31
for maintenance.
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
BioCyc websites down
12/28 - 12/31
for maintenance.
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
BioCyc websites down
12/28 - 12/31
for maintenance.
Metabolic Modeling Tutorial
discounted EARLY registration ends Dec 31, 2014
BioCyc websites down
12/28 - 12/31
for maintenance.
twitter

Escherichia coli K-12 substr. MG1655 Polypeptide: paraquat-inducible protein A



Gene: pqiA Accession Numbers: G6490 (EcoCyc), b0950, ECK0941

Synonyms: pqi5, pqi5A

Regulation Summary Diagram: ?

Summary:
During exponential phase growth, expression of pqiAB is inducible by paraquat and other superoxide generators such as menadione, phenazine methosulfate, and plumbagin, but not by hydrogen peroxide, ethanol, and heat shock. pqiAB is a member of the soxRS regulon [Koh95]. Carbon or phosphate starvation during stationary phase leads to an RpoS-dependent increase in pqiAB expression [Koh96].

A pqiA mutant has no obvious phenotype, including no change in resistance to oxidants [Koh95].

Locations: inner membrane

Map Position: [1,011,224 -> 1,012,477] (21.8 centisomes)
Length: 1254 bp / 417 aa

Molecular Weight of Polypeptide: 46.464 kD (from nucleotide sequence)

Unification Links: ASAP:ABE-0003219 , EchoBASE:EB2794 , EcoGene:EG12965 , EcoliWiki:b0950 , OU-Microarray:b0950 , PortEco:pqiA , PR:PRO_000023585 , Protein Model Portal:P0AFL9 , RefSeq:NP_415470 , RegulonDB:G6490 , String:511145.b0950 , UniProt:P0AFL9

Relationship Links: InterPro:IN-FAMILY:IPR005219 , InterPro:IN-FAMILY:IPR007498 , Pfam:IN-FAMILY:PF04403

Genetic Regulation Schematic: ?

GO Terms:

Biological Process: GO:0006950 - response to stress Inferred from experiment [Koh95]
Cellular Component: GO:0005886 - plasma membrane Inferred from experiment Inferred by computational analysis [UniProtGOA11, UniProtGOA11a, DiazMejia09, Daley05]
GO:0016020 - membrane Inferred by computational analysis [UniProtGOA11a, Koh95]
GO:0016021 - integral component of membrane Inferred by computational analysis [UniProtGOA11a]

Gene Class: UNCLASSIFIED

Essentiality data for pqiA knockouts: ?

Growth Medium Growth? T (°C) O2 pH Osm/L Growth Observations
LB enriched Yes 37 Aerobic 6.95   Yes [Gerdes03, Comment 1]
LB Lennox Yes 37 Aerobic 7   Yes [Baba06, Comment 2]
M9 medium with 1% glycerol Yes 37 Aerobic 7.2 0.35 Yes [Joyce06, Comment 3]
MOPS medium with 0.4% glucose Yes 37 Aerobic 7.2 0.22 Yes [Baba06, Comment 2]

Sequence Features

Feature Class Location Citations Comment
Transmembrane-Region 51 -> 71
[UniProt10]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 102 -> 122
[UniProt10]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 150 -> 170
[UniProt10]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 257 -> 277
[UniProt10]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 285 -> 305
[UniProt10]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 306 -> 326
[UniProt10]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Sequence-Conflict 338 -> 417
[Koh95, UniProt10a]
Alternate sequence: SERMHLIYEVVEFVGRWSMIDVFVIAVLSALVRMGGLMSIYPAMGALMFALVVIMTMFSAMTFDPRLSWDRQPESEHEES → RKECI; UniProt: (in Ref. 1; CAA57256);
Transmembrane-Region 347 -> 367
[UniProt10]
UniProt: Helical;; Non-Experimental Qualifier: potential;
Transmembrane-Region 372 -> 392
[UniProt10]
UniProt: Helical;; Non-Experimental Qualifier: potential;


Gene Local Context (not to scale): ?

Transcription Units:

Notes:

History:
Markus Krummenacker on Tue Oct 14, 1997:
Gene object created from Blattner lab Genbank (v. M52) entry.


References

Baba06: Baba T, Ara T, Hasegawa M, Takai Y, Okumura Y, Baba M, Datsenko KA, Tomita M, Wanner BL, Mori H (2006). "Construction of Escherichia coli K-12 in-frame, single-gene knockout mutants: the Keio collection." Mol Syst Biol 2;2006.0008. PMID: 16738554

Daley05: Daley DO, Rapp M, Granseth E, Melen K, Drew D, von Heijne G (2005). "Global topology analysis of the Escherichia coli inner membrane proteome." Science 308(5726);1321-3. PMID: 15919996

DiazMejia09: Diaz-Mejia JJ, Babu M, Emili A (2009). "Computational and experimental approaches to chart the Escherichia coli cell-envelope-associated proteome and interactome." FEMS Microbiol Rev 33(1);66-97. PMID: 19054114

Gerdes03: Gerdes SY, Scholle MD, Campbell JW, Balazsi G, Ravasz E, Daugherty MD, Somera AL, Kyrpides NC, Anderson I, Gelfand MS, Bhattacharya A, Kapatral V, D'Souza M, Baev MV, Grechkin Y, Mseeh F, Fonstein MY, Overbeek R, Barabasi AL, Oltvai ZN, Osterman AL (2003). "Experimental determination and system level analysis of essential genes in Escherichia coli MG1655." J Bacteriol 185(19);5673-84. PMID: 13129938

Joyce06: Joyce AR, Reed JL, White A, Edwards R, Osterman A, Baba T, Mori H, Lesely SA, Palsson BO, Agarwalla S (2006). "Experimental and computational assessment of conditionally essential genes in Escherichia coli." J Bacteriol 188(23);8259-71. PMID: 17012394

Koh95: Koh YS, Roe JH (1995). "Isolation of a novel paraquat-inducible (pqi) gene regulated by the soxRS locus in Escherichia coli." J Bacteriol 1995;177(10);2673-8. PMID: 7751275

Koh96: Koh YS, Roe JH (1996). "Dual regulation of the paraquat-inducible gene pqi-5 by SoxS and RpoS in Escherichia coli." Mol Microbiol 1996;22(1);53-61. PMID: 8899708

UniProt10: UniProt Consortium (2010). "UniProt version 2010-07 released on 2010-06-15 00:00:00." Database.

UniProt10a: UniProt Consortium (2010). "UniProt version 2010-11 released on 2010-11-02 00:00:00." Database.

UniProtGOA11: UniProt-GOA (2011). "Gene Ontology annotation based on the manual assignment of UniProtKB Subcellular Location terms in UniProtKB/Swiss-Prot entries."

UniProtGOA11a: UniProt-GOA (2011). "Gene Ontology annotation based on manual assignment of UniProtKB keywords in UniProtKB/Swiss-Prot entries."

Other References Related to Gene Regulation

Martin11a: Martin RG, Rosner JL (2011). "Promoter discrimination at class I MarA regulon promoters mediated by glutamic acid 89 of the MarA transcriptional activator of Escherichia coli." J Bacteriol 193(2);506-15. PMID: 21097628

Martin99: Martin RG, Gillette WK, Rhee S, Rosner JL (1999). "Structural requirements for marbox function in transcriptional activation of mar/sox/rob regulon promoters in Escherichia coli: sequence, orientation and spatial relationship to the core promoter." Mol Microbiol 1999;34(3);431-41. PMID: 10564485


Report Errors or Provide Feedback
Please cite the following article in publications resulting from the use of EcoCyc: Nucleic Acids Research 41:D605-12 2013
Page generated by SRI International Pathway Tools version 18.5 on Sat Dec 20, 2014, BIOCYC14B.